
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-NEK7 Antibody
상품 한눈에 보기
Human NEK7 단백질을 표적으로 하는 폴리클로날 항체. Rabbit에서 생산된 IgG 형식으로, IHC 등 다양한 연구 응용에 적합. PrEST 항원을 이용해 친화 정제된 고품질 항체. Human에 대해 검증된 반응성을 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA018193-100 Anti-NEK7 Antibody, NIMA-related kinase 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018193-25 Anti-NEK7 Antibody, NIMA-related kinase 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NEK7 Antibody
Anti-NEK7 Antibody
Target Information
- Target Protein: NIMA-related kinase 7
- Target Gene: NEK7
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
MDEQSQGMQGPPVPQFQPQKALRPDMGYNTLANFRIEKKIGRGQFSEVYRAACLLDGVPVAL
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000000657 (97%)
- Mouse ENSMUSG00000026393 (97%)
Product Description
Polyclonal Antibody against Human NEK7
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Recommended Applications
IHC (Immunohistochemistry)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



