CacheBy
Atlas Antibodies Anti-NEK7 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NEK7 Antibody

상품 한눈에 보기

Human NEK7 단백질을 표적으로 하는 폴리클로날 항체. Rabbit에서 생산된 IgG 형식으로, IHC 등 다양한 연구 응용에 적합. PrEST 항원을 이용해 친화 정제된 고품질 항체. Human에 대해 검증된 반응성을 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA018193-100 Anti-NEK7 Antibody, NIMA-related kinase 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018193-25 Anti-NEK7 Antibody, NIMA-related kinase 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NEK7 Antibody

Anti-NEK7 Antibody

Target Information

  • Target Protein: NIMA-related kinase 7
  • Target Gene: NEK7
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    MDEQSQGMQGPPVPQFQPQKALRPDMGYNTLANFRIEKKIGRGQFSEVYRAACLLDGVPVAL

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000000657 (97%)
  • Mouse ENSMUSG00000026393 (97%)

Product Description

Polyclonal Antibody against Human NEK7

Open Datasheet (PDF)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

IHC (Immunohistochemistry)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.