
Atlas Antibodies Anti-NEK7 Antibody
상품 한눈에 보기
Human NEK7 단백질을 표적으로 하는 폴리클로날 항체. Rabbit에서 생산된 IgG 형식으로, IHC 등 다양한 연구 응용에 적합. PrEST 항원을 이용해 친화 정제된 고품질 항체. Human에 대해 검증된 반응성을 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NEK7 Antibody
Target Information
- Target Protein: NIMA-related kinase 7
- Target Gene: NEK7
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
MDEQSQGMQGPPVPQFQPQKALRPDMGYNTLANFRIEKKIGRGQFSEVYRAACLLDGVPVAL
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000000657 (97%)
- Mouse ENSMUSG00000026393 (97%)
Product Description
Polyclonal Antibody against Human NEK7
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Recommended Applications
IHC (Immunohistochemistry)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.




