CacheBy
Atlas Antibodies Anti-NEK3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NEK3 Antibody

상품 한눈에 보기

Human NEK3 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. Human에 반응하며, 40% glycerol 기반 PBS buffer에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA043230-100 Anti-NEK3 Antibody, NIMA-related kinase 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043230-25 Anti-NEK3 Antibody, NIMA-related kinase 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NEK3 Antibody

Anti-NEK3 Antibody

Target: NIMA-related kinase 3 (NEK3)
Type: Polyclonal Antibody against Human NEK3


  • Immunohistochemistry (IHC)

Product Description

This polyclonal antibody is raised in rabbit against human NEK3 protein.


Alternative Gene Names

  • HSPK36
  • MGC29949

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein NIMA-related kinase 3
Target Gene NEK3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence NLILKVCQGCISPLPSHYSYELQFLVKQMFKRNPSHRPSATTLLSRGIVARLVQKCLPPEIIMEYGEEVLEEIKNSKHNTPRKKTNPSRIRIALGNEASTV

Verified Species Reactivity

  • Human

Interspecies Information

종 Ortholog ID 항원 서열 유사도
Mouse ENSMUSG00000031478 64%
Rat ENSRNOG00000012757 60%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications: IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.