Atlas Antibodies Anti-NEK4 Antibody

상품 한눈에 보기

Human NEK4 단백질을 인식하는 폴리클로날 토끼 항체로, IHC 등 다양한 응용에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. 인간과 설치류 간 교차 반응 정보 포함.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA058543-100 Anti-NEK4 Antibody, NIMA related kinase 4 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA058543-25 Anti-NEK4 Antibody, NIMA related kinase 4 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-NEK4 Antibody

Anti-NEK4 Antibody

Target Information

Target Protein: NIMA-related kinase 4
Target Gene: NEK4
Alternative Gene Names: NRK2, pp12301, STK2

Recommended Applications

면역조직화학 (IHC)

Product Description

Polyclonal Antibody against Human NEK4

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

VAGECIIEKQGRIHPDLQPHNSGSEPSLSRQRRQKRREQTEHRGEKRQVRRDLFAFQESPPRFLPSHPIVGKVDVTSTQKEAENQRRVVTGSVSSSRSSEMSSSKDRPLSARERRRLKQSQEEMSSSGPSVRKASLSVAGPGKPQEEDQP

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000017997 (62%)
Mouse ENSMUSG00000021918 (60%)

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Recommended Applications	IHC
Species Reactivity	Human
Cross-reactivity	Rat (62%), Mouse (60%)