CacheBy
Atlas Antibodies Anti-NEK1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NEK1 Antibody

상품 한눈에 보기

Human NEK1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC Orthogonal 검증 완료. RNA-seq 데이터 기반 단백질 발현 검증에 적합. 고순도 Affinity 정제 항체로 안정적인 신뢰성 제공. 다양한 조직 발현 연구에 활용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA040413-100 Anti-NEK1 Antibody, NIMA-related kinase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040413-25 Anti-NEK1 Antibody, NIMA-related kinase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NEK1 Antibody

Anti-NEK1 Antibody

NIMA-related kinase 1 (NEK1)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human NEK1

Alternative Gene Names

KIAA1901, NY-REN-55

Open Datasheet

Target Information

항목 내용
Target Protein NIMA-related kinase 1
Target Gene NEK1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence NLKAQEDEKGKQNLSDTFEINVHEDAKEHEKEKSVSSDRKKWEAGGQLVIPLDELTLDTSFSTTERHTVGEVIKLGPNGSPRRAWGKSPTDSVLKILGEAELQLQTELLENTTIRSEISPEGEKYKPLITGEKKVQCISHEINPSA
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000031644 (72%), Rat ENSRNOG00000010418 (71%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.