Atlas Antibodies Anti-NECAB3 Antibody

상품 한눈에 보기

Human NECAB3 단백질을 인식하는 고품질 폴리클로날 항체입니다. Rabbit 호스트에서 생산되었으며 IgG 아이소타입입니다. Affinity purification 방식으로 정제되어 높은 특이성과 재현성을 제공합니다. 면역염색(ICC 등)에 적합하며 Human에 대한 반응성이 검증되었습니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA044785-100 Anti-NECAB3 Antibody, N-terminal EF-hand calcium binding protein 3 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA044785-25 Anti-NECAB3 Antibody, N-terminal EF-hand calcium binding protein 3 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-NECAB3 Antibody

Anti-NECAB3 Antibody

Target: N-terminal EF-hand calcium binding protein 3
Supplier: Atlas Antibodies

Recommended Applications

면역세포화학(ICC)

Product Description

Polyclonal Antibody against Human NECAB3

Alternative Gene Names

APBA2BP, dJ63M2.4, dJ63M2.5, EFCBP3, NIP1, SYTIP2, XB51

Open Datasheet

Target Information

Target Protein: N-terminal EF-hand calcium binding protein 3
Target Gene: NECAB3
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

QDFHRALRCYVDFTGAQSHCLHVSAQKMLDGASFTLYEFWQDEASWRRHQQSPGSKAFQRILIDHLRAPDTLTTVFFPASWWIMNN

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Identity
Rat	ENSRNOG00000016708	92%
Mouse	ENSMUSG00000027489	91%

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Purification Method	Affinity purified using the PrEST antigen as affinity ligand