
Atlas Antibodies Anti-NDUFAF2 Antibody
상품 한눈에 보기
Human NDUFAF2 단백질을 인식하는 폴리클로날 항체로, WB 및 ICC에 적합. Rabbit에서 생산된 IgG 형 항체이며, PrEST 항원으로 특이적 정제됨. 인간에 대해 검증된 반응성을 가지며, 40% glycerol/PBS buffer에 보존됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NDUFAF2 Antibody
NADH dehydrogenase (ubiquinone) complex I, assembly factor 2
Recommended Applications
- WB (Independent antibody validation)
- ICC
Validation of protein expression in WB
Independent antibodies targeting different epitopes of the protein were compared for validation.
Product Description
Polyclonal antibody against human NDUFAF2.
Alternative Gene Names
B17.2L, mimitin, MMTN, NDUFA12L
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | NADH dehydrogenase (ubiquinone) complex I, assembly factor 2 |
| Target Gene | NDUFAF2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Homology | Mouse (80%), Rat (75%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Antigen Sequence
MGWSQDLFRALWRSLSREVKEHVGTDQFGNKYYYIPQYKNWRGQTIREKRIVEAANKKEVDYEAGDIPTEWEAWIRRTRKTPPNotes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference
Material Safety Data Sheet (Sodium Azide)
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-NDUFAF5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NDUFAF4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NDUFAF2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NDUFAF3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NDUFAF3 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.