CacheBy
Atlas Antibodies Anti-NCEH1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NCEH1 Antibody

상품 한눈에 보기

Human NCEH1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원을 이용해 Affinity 정제되었으며, 높은 특이성과 재현성을 제공합니다. PBS와 글리세롤 완충액에 보존되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA026888-100 Anti-NCEH1 Antibody, neutral cholesterol ester hydrolase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026888-25 Anti-NCEH1 Antibody, neutral cholesterol ester hydrolase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NCEH1 Antibody

Anti-NCEH1 Antibody

Target: Neutral cholesterol ester hydrolase 1 (NCEH1)
Type: Polyclonal Antibody against Human NCEH1


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human NCEH1 (neutral cholesterol ester hydrolase 1).


Alternative Gene Names

AADACL1, KIAA1363, NCEH

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Neutral cholesterol ester hydrolase 1
Target Gene NCEH1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence ALIYPVLQALDFNTPSYQQNVNTPILPRYVMVKYWVDYFKGNYDFVQAMIVNNHTSLDVEEAAAVRARLNWTSLLPASFTKNYKPVVQTTGNARIVQELPQLLDARSAPLIADQAVLQLLPKTYILTCEHDVL
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000013313 (83%), Mouse ENSMUSG00000027698 (83%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.