CacheBy
Atlas Antibodies Anti-NBPF4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NBPF4 Antibody

상품 한눈에 보기

Human NBPF4 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 인간에 대해 검증된 반응성을 제공합니다. 안정적인 PBS/glycerol 버퍼에 보존되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA045044-100 Anti-NBPF4 Antibody, neuroblastoma breakpoint family, member 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045044-25 Anti-NBPF4 Antibody, neuroblastoma breakpoint family, member 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NBPF4 Antibody

Anti-NBPF4 Antibody

Target: Neuroblastoma breakpoint family, member 4 (NBPF4)
Supplier: Atlas Antibodies


면역조직화학 (IHC)


Product Description

Polyclonal antibody against Human NBPF4.


Alternative Gene Names

  • FLJ32833

Open Datasheet (PDF)


Target Information

  • Target Protein: Neuroblastoma breakpoint family, member 4
  • Target Gene: NBPF4
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
RLSQELPEVKEQEVPEDSVNEVYLTPSVHHDVSDCHQPYSSTLSSLEDQLACSALDVASPTEAACPQGTWSGDLSHH

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000038170 32%
Rat ENSRNOG00000018220 32%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.