CacheBy
Atlas Antibodies Anti-NAT6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NAT6 Antibody

상품 한눈에 보기

Human NAT6 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. 고순도의 Affinity purified 항체이며, Human, Mouse, Rat에 반응합니다. 40% glycerol/PBS 완충액에 보존되어 안정성이 우수합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039576-100 Anti-NAT6 Antibody, N-acetyltransferase 6 (GCN5-related) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039576-25 Anti-NAT6 Antibody, N-acetyltransferase 6 (GCN5-related) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NAT6 Antibody

Anti-NAT6 Antibody

N-acetyltransferase 6 (GCN5-related)

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal Antibody against Human NAT6

Alternative Gene Names

  • FUS2

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein N-acetyltransferase 6 (GCN5-related)
Target Gene NAT6
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence PSLAELTLEPVHRRPELLDACADLINDQWPRSRTSRLHSLGQSSDAFPLCLMLLSPHPTLEAAPVVVGHARLSRVLN

Verified Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information

Ortholog ID 항원 서열 유사도
Rat ENSRNOG00000054063 87%
Mouse ENSMUSG00000079334 86%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.