CacheBy
Atlas Antibodies Anti-MSRB1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MSRB1 Antibody

상품 한눈에 보기

인간 MSRB1 단백질을 인식하는 토끼 폴리클로날 항체입니다. 메싸이오닌 설폭사이드 환원효소 B1 연구용으로 적합하며, 높은 특이성과 재현성을 제공합니다. PrEST 항원을 이용해 친화 정제되었으며, 인체 반응성이 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043463-100 Anti-MSRB1 Antibody, methionine sulfoxide reductase B1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043463-25 Anti-MSRB1 Antibody, methionine sulfoxide reductase B1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MSRB1 Antibody

Anti-MSRB1 Antibody

Target: methionine sulfoxide reductase B1 (MSRB1)
Supplier: Atlas Antibodies

Product Description

Polyclonal antibody against human MSRB1 (methionine sulfoxide reductase B1).

  • ICC (Immunocytochemistry)

Alternative Gene Names

SelR, SelX, SepR, SEPX1

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein methionine sulfoxide reductase B1
Target Gene MSRB1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence LVQMWETGQVSCTGSRTKVNLLCRRSAWEMGVWEETPSASPSKGLHCGCIMARSSPSCLVIFPGVLWQVWQWVGPRVPERRPQAGAVPILNIQQLAEVCP

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000040209 (27%)
  • Rat ENSRNOG00000017419 (24%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.