AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MSRB1 Antibody
상품 한눈에 보기
인간 MSRB1 단백질을 인식하는 토끼 폴리클로날 항체입니다. 메싸이오닌 설폭사이드 환원효소 B1 연구용으로 적합하며, 높은 특이성과 재현성을 제공합니다. PrEST 항원을 이용해 친화 정제되었으며, 인체 반응성이 검증되었습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA043463-100 Anti-MSRB1 Antibody, methionine sulfoxide reductase B1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043463-25 Anti-MSRB1 Antibody, methionine sulfoxide reductase B1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MSRB1 Antibody
Anti-MSRB1 Antibody
Target: methionine sulfoxide reductase B1 (MSRB1)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human MSRB1 (methionine sulfoxide reductase B1).
Recommended Applications
- ICC (Immunocytochemistry)
Alternative Gene Names
SelR, SelX, SepR, SEPX1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | methionine sulfoxide reductase B1 |
| Target Gene | MSRB1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | LVQMWETGQVSCTGSRTKVNLLCRRSAWEMGVWEETPSASPSKGLHCGCIMARSSPSCLVIFPGVLWQVWQWVGPRVPERRPQAGAVPILNIQQLAEVCP |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000040209 (27%)
- Rat ENSRNOG00000017419 (24%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.