Atlas Antibodies Anti-MSRB1 Antibody
상품 한눈에 보기
인간 MSRB1 단백질을 인식하는 토끼 폴리클로날 항체입니다. 메싸이오닌 설폭사이드 환원효소 B1 연구용으로 적합하며, 높은 특이성과 재현성을 제공합니다. PrEST 항원을 이용해 친화 정제되었으며, 인체 반응성이 검증되었습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MSRB1 Antibody
Target: methionine sulfoxide reductase B1 (MSRB1)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human MSRB1 (methionine sulfoxide reductase B1).
Recommended Applications
- ICC (Immunocytochemistry)
Alternative Gene Names
SelR, SelX, SepR, SEPX1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | methionine sulfoxide reductase B1 |
| Target Gene | MSRB1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | LVQMWETGQVSCTGSRTKVNLLCRRSAWEMGVWEETPSASPSKGLHCGCIMARSSPSCLVIFPGVLWQVWQWVGPRVPERRPQAGAVPILNIQQLAEVCP |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000040209 (27%)
- Rat ENSRNOG00000017419 (24%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.