
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-NADK2 Antibody
상품 한눈에 보기
인간 NADK2 단백질에 특이적인 폴리클로날 항체로, IHC 및 Western blot에서 검증됨. Orthogonal 및 Independent validation을 통해 높은 신뢰성 확보. Rabbit 유래 IgG로, PrEST 항원으로 정제됨. 인간 시료에 적합한 고품질 연구용 항체.
- 카탈로그번호
- HPA038367-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA038367-100 Anti-NADK2 Antibody, NAD kinase 2, mitochondrial 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038367-25 Anti-NADK2 Antibody, NAD kinase 2, mitochondrial 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-NADK2 Antibody
Anti-NADK2 Antibody
NAD kinase 2, mitochondrial
Recommended Applications
- Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against Human NADK2
Alternative Gene Names
C5orf33, FLJ30596, MNADK, NADKD1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | NAD kinase 2, mitochondrial |
| Target Gene | NADK2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000054157 (98%), Mouse ENSMUSG00000111527 (97%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
Antigen Sequence
RELVEKVTNEYNESLLYSPEEPKILFSIREPIANRVFSSSRQRCFSSKVCVRSRCWDACMVVDGGTSFEFNDGAIASMMINKEDELRTVLLE제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



