
Atlas Antibodies Anti-NADK2 Antibody
상품 한눈에 보기
인간 NADK2 단백질에 특이적인 폴리클로날 항체로, IHC 및 Western blot에서 검증됨. Orthogonal 및 Independent validation을 통해 높은 신뢰성 확보. Rabbit 유래 IgG로, PrEST 항원으로 정제됨. 인간 시료에 적합한 고품질 연구용 항체.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-NADK2 Antibody
NAD kinase 2, mitochondrial
Recommended Applications
- Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against Human NADK2
Alternative Gene Names
C5orf33, FLJ30596, MNADK, NADKD1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | NAD kinase 2, mitochondrial |
| Target Gene | NADK2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000054157 (98%), Mouse ENSMUSG00000111527 (97%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
Antigen Sequence
RELVEKVTNEYNESLLYSPEEPKILFSIREPIANRVFSSSRQRCFSSKVCVRSRCWDACMVVDGGTSFEFNDGAIASMMINKEDELRTVLLE제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-NADK2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NADSYN1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NADK2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NADK Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-NADK Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.