CacheBy
Atlas Antibodies Anti-NADK2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-NADK2 Antibody

상품 한눈에 보기

인간 NADK2 단백질에 특이적인 폴리클로날 항체로, IHC 및 Western blot에서 검증됨. Orthogonal 및 Independent validation을 통해 높은 신뢰성 확보. Rabbit 유래 IgG로, PrEST 항원으로 정제됨. 인간 시료에 적합한 고품질 연구용 항체.

카탈로그번호
HPA038367-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA038367-100 Anti-NADK2 Antibody, NAD kinase 2, mitochondrial 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038367-25 Anti-NADK2 Antibody, NAD kinase 2, mitochondrial 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-NADK2 Antibody

Anti-NADK2 Antibody

NAD kinase 2, mitochondrial


  • Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Product Description

Polyclonal antibody against Human NADK2


Alternative Gene Names

C5orf33, FLJ30596, MNADK, NADKD1

Open Datasheet


Target Information

항목 내용
Target Protein NAD kinase 2, mitochondrial
Target Gene NADK2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000054157 (98%), Mouse ENSMUSG00000111527 (97%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Antigen Sequence

RELVEKVTNEYNESLLYSPEEPKILFSIREPIANRVFSSSRQRCFSSKVCVRSRCWDACMVVDGGTSFEFNDGAIASMMINKEDELRTVLLE

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
WB Independent
Independent Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.