
Atlas Antibodies Anti-MYO15A Antibody
상품 한눈에 보기
Human MYO15A 단백질을 인식하는 토끼 폴리클로날 항체로, myosin XVA 검출에 적합합니다. Affinity purification으로 높은 특이성과 재현성을 제공합니다. IHC 등 다양한 응용에 사용 가능하며, 40% glycerol 기반 완충용액에 보존되어 있습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MYO15A Antibody
제품 설명
Polyclonal Antibody against Human MYO15A (myosin XVA)
Alternative Gene Names: DFNB3, MYO15
- Clonality: Polyclonal
- Host: Rabbit
- Isotype: IgG
- Recommended Applications: IHC (Immunohistochemistry)
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
LHPHLTRFLQDVSRTPGLPFQGIAKACEQNLQKTLRFGGRLELPSSIELRAMLAGRSSKRQLFLLPGGLERHLKIKTCTVALDVVEEICAEMA
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to orthologs:
- Rat ENSRNOG00000059219 (87%)
- Mouse ENSMUSG00000042678 (86%)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide (preservative)
Material Safety Data Sheet
사용 시 주의사항
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 사용자가 실험별로 결정해야 합니다.
제품 스펙 요약
| 항목 | 내용 |
|---|---|
| Target Protein | myosin XVA |
| Target Gene | MYO15A |
| Alternative Names | DFNB3, MYO15 |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Verified Reactivity | Human |
| Ortholog Identity | Rat (87%), Mouse (86%) |
| Purification | Affinity purified (PrEST antigen) |
| Buffer | 40% glycerol, PBS (pH 7.2), 0.02% sodium azide |
| Applications | IHC |
| Storage | Store as recommended by manufacturer |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MYO10 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MYO16 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MYO15A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MYLK2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MYLPF Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.