Atlas Antibodies Anti-MURC Antibody
상품 한눈에 보기
인체 MURC 단백질을 표적으로 하는 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. 정제된 PrEST 항원 기반 친화 정제 방식으로 제작되었습니다. Rabbit 호스트, IgG 아이소타입, 인체 반응성 검증 완료. Orthogonal 및 Recombinant Expression 검증 지원.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MURC Antibody
muscle-related coiled-coil protein
Recommended Applications
- IHC Orthogonal Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB Recombinant Expression Validation: Recombinant expression validation in WB using target protein overexpression.
- ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human MURC
Alternative Gene Names
- cavin-4
- CAVIN4
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | muscle-related coiled-coil protein |
| Target Gene | MURC |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000028348 (64%), Rat ENSRNOG00000008027 (59%) |
Antigen Sequence:
KGKDRTVAEGEECAREMGVDIIARSESLGPISELYSDELSEPEHEAARPVYPPHEGREIPTPEPLKVTFKSQVKVEDDESLLL
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.