
Atlas Antibodies Anti-MS4A8 Antibody
상품 한눈에 보기
Human MS4A8 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 검증 완료. Rabbit에서 생산된 IgG 항체이며, PrEST 항원을 이용해 친화 정제됨. 40% glycerol 기반 완충액에 보존되어 안정적이며, 인간 단백질 발현 분석에 적합.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MS4A8 Antibody
membrane-spanning 4-domains, subfamily A, member 8
Recommended Applications
IHC (Independent Antibody Validation)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.WB (Recombinant Expression Validation)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human MS4A8
Alternative Gene Names
CD20L5, MS4A4, MS4A8B
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | membrane-spanning 4-domains, subfamily A, member 8 |
| Target Gene | MS4A8 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | MNSMTSAVPVANSVLVVAPHNGYPVTPGIMSHVPLYPNSQPQVHLVPGNPPSLVSNVNGQPVQKALKEGK |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000020939 (61%), Mouse ENSMUSG00000024730 (51%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MSANTD4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MS4A6A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MS4A8 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MSANTD2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MSANTD3 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.