
Atlas Antibodies Anti-MS4A4E Antibody
상품 한눈에 보기
Human MS4A4E 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, PBS와 글리세롤 버퍼에 보존됩니다. 사람에 대해 검증된 반응성을 가집니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MS4A4E Antibody
Target: membrane-spanning 4-domains, subfamily A, member 4E (MS4A4E)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody against human MS4A4E protein.
Affinity purified using the PrEST antigen as affinity ligand.
Target Information
- Target Protein: membrane-spanning 4-domains, subfamily A, member 4E
- Target Gene: MS4A4E
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LQQELEQQKVWNYLKNLSWRIMGSYLCFGERSELKPL
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000001436): 37%
- Rat (ENSRNOG00000000165): 30%
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide added as preservative
Material Safety Data Sheet
Notes
Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MSANTD3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MS4A5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MS4A4E Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MS4A15 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MS4A4A Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.