
Atlas Antibodies Anti-MRPS7 Antibody
Human MRPS7 타깃의 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. Rabbit 호스트에서 생산되었으며, PrEST 항원으로 정제되었습니다. Human, Mouse, Rat 반응성이 검증된 고품질 항체입니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MRPS7 Antibody
Target: Mitochondrial ribosomal protein S7 (MRPS7)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human MRPS7.
Alternative Gene Names
MRP-S, RP-S7, RPMS7
Target Information
- Target Protein: Mitochondrial ribosomal protein S7
- Target Gene: MRPS7
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
TSSVFEDPVISKFTNMMMIGGNKVLARSLMIQTLEAVKRKQFEKYHAASAEEQATIERNPYTIFHQALKNCEPMIGLVPI
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information
| Species | Gene ID | Antigen Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000046756 | 91% |
| Rat | ENSRNOG00000003797 | 90% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2)
0.02% sodium azide added as preservative
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MRPS9 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MRPS7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MRPS7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MRPS35 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MRPS6 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|