AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MRPS7 Antibody
상품 한눈에 보기
Human MRPS7 타깃의 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. Rabbit 호스트에서 생산되었으며, PrEST 항원으로 정제되었습니다. Human, Mouse, Rat 반응성이 검증된 고품질 항체입니다.
- 카탈로그번호
- HPA022522-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA022522-100 Anti-MRPS7 Antibody, mitochondrial ribosomal protein S7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA022522-25 Anti-MRPS7 Antibody, mitochondrial ribosomal protein S7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MRPS7 Antibody
Anti-MRPS7 Antibody
Target: Mitochondrial ribosomal protein S7 (MRPS7)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human MRPS7.
Alternative Gene Names
MRP-S, RP-S7, RPMS7
Target Information
- Target Protein: Mitochondrial ribosomal protein S7
- Target Gene: MRPS7
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
TSSVFEDPVISKFTNMMMIGGNKVLARSLMIQTLEAVKRKQFEKYHAASAEEQATIERNPYTIFHQALKNCEPMIGLVPI
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information
| Species | Gene ID | Antigen Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000046756 | 91% |
| Rat | ENSRNOG00000003797 | 90% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2)
0.02% sodium azide added as preservative
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.