CacheBy
Atlas Antibodies Anti-MRPS22 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MRPS22 Antibody

상품 한눈에 보기

Human MRPS22 단백질을 표적으로 하는 Rabbit Polyclonal 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 독립 항체 비교 및 siRNA 노크다운을 통한 검증 완료. Human, Mouse, Rat에 반응하며, PrEST 항원을 이용해 친화 정제되었습니다.

카탈로그번호
HPA006083-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA006083-100 Anti-MRPS22 Antibody, mitochondrial ribosomal protein S22 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA006083-25 Anti-MRPS22 Antibody, mitochondrial ribosomal protein S22 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MRPS22 Antibody

Anti-MRPS22 Antibody

Target: mitochondrial ribosomal protein S22 (MRPS22)
Supplier: Atlas Antibodies


  • IHC (Independent Antibody Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Genetic Validation): Genetic validation in WB by siRNA knockdown.
  • ICC: Immunocytochemistry applications supported.

Product Description

Polyclonal Antibody against Human MRPS22


Alternative Gene Names

C3orf5, GIBT, GK002, MRP-S22

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein mitochondrial ribosomal protein S22
Target Gene MRPS22
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human, Mouse, Rat
Interspecies Identity Rat ENSRNOG00000047984 (93%), Mouse ENSMUSG00000032459 (91%)

Antigen sequence:

TKKPTFMDEEVQSILTKMTGLNLQKTFKPAIQELKPPTYKLMTQAQLEEATRQAVEAAKVRLKMPPVLEERVPINDVLAEDKILEGTETTKYVFTDISYSIPHRERFIVVREPSGTLRKA

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Validation
WB Validation
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.