CacheBy
Atlas Antibodies Anti-MRPS21 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MRPS21 Antibody

상품 한눈에 보기

인간 MRPS21 단백질을 인식하는 폴리클로날 항체로, 미토콘드리아 리보솜 단백질 S21 검출에 적합합니다. 토끼 유래 IgG 항체이며, PrEST 항원으로 친화 정제되었습니다. 인간에 대한 반응성이 검증되었으며, ICC 등 다양한 응용에 사용 가능합니다.

카탈로그번호
HPA078289-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA078289-100 Anti-MRPS21 Antibody, mitochondrial ribosomal protein S21 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA078289-25 Anti-MRPS21 Antibody, mitochondrial ribosomal protein S21 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MRPS21 Antibody

Anti-MRPS21 Antibody

Target Information

  • Target Protein: Mitochondrial ribosomal protein S21
  • Target Gene: MRPS21
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
MAKHLKFIARTVMVQEGNVESAYRTLNRILTMDGLIEDIKHRRYYEKPC

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat: ENSRNOG00000024845 (90%)
  • Mouse: ENSMUSG00000054312 (88%)

Product Description

Polyclonal antibody against human MRPS21.

  • Immunocytochemistry (ICC)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Documents

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.