
Thermo Fisher Scientific ac Polyclonal Antibody
상품 한눈에 보기
Fruit fly 유래 ac 단백질에 특이적인 rabbit polyclonal antibody로 Western blot에 적합. 합성 펩타이드(aa 21-70)를 면역원으로 사용하며, 0.5 mg/mL 액상 형태로 제공. PBS 및 sucrose buffer에 보관하며, -20°C에서 장기 보관 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Thermo Fisher Scientific ac Polyclonal Antibody
Applications
- Western Blot (WB)
Tested Dilution: 0.2–1.0 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Fruit fly |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to a region of fruit fly ac (aa 21–70) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.5 mg/mL |
| Purification | Affinity chromatography |
| Storage Buffer | PBS with 2% sucrose |
| Contains | 0.09% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2689198 |
Product Specific Information
- Target displays homology in the following species:
- Human: 79%
- Rat: 85%
- Peptide sequence: FNGPSVIRRNARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGA
- For short-term use: store at 2–8°C up to 1 week
- For long-term storage: store at -20°C in small aliquots to prevent freeze-thaw cycles
- Concentration is batch dependent: 0.5–1 mg/mL
Target Information
AS-C proteins are involved in the determination of neuronal precursors in the peripheral and central nervous systems.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 파일: PA5-69771_ac_P10083-1_Rabbit.svg, PA5-69771_ac_P10083-1_Rabbit_PDP.jpeg)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific MYCNOS Polyclonal Antibody
642,300원

Thermo Fisher Scientific
Thermo Fisher Scientific PHF23 Polyclonal Antibody
642,300원

Thermo Fisher Scientific
Thermo Fisher Scientific ac Polyclonal Antibody
642,300원

Thermo Fisher Scientific
Thermo Fisher Scientific FANK1 Polyclonal Antibody
642,300원

Thermo Fisher Scientific
Thermo Fisher Scientific PHF22 Polyclonal Antibody
642,300원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.