원본
Thermo Fisher Scientific ac Polyclonal Antibody
상품 한눈에 보기
Fruit fly 유래 ac 단백질에 특이적인 rabbit polyclonal antibody로 Western blot에 적합. 합성 펩타이드(aa 21-70)를 면역원으로 사용하며, 0.5 mg/mL 액상 형태로 제공. PBS 및 sucrose buffer에 보관하며, -20°C에서 장기 보관 가능.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오전 07:57
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA569771 ac Polyclonal Antibody 100 ul pk판매 단위 pk ·
재고 확인 필요
642,300원VAT 포함 706,530원
Thermo Fisher Scientific · Thermo Fisher Scientific ac Polyclonal Antibody
Thermo Fisher Scientific ac Polyclonal Antibody
Applications
- Western Blot (WB)
Tested Dilution: 0.2–1.0 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Fruit fly |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to a region of fruit fly ac (aa 21–70) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.5 mg/mL |
| Purification | Affinity chromatography |
| Storage Buffer | PBS with 2% sucrose |
| Contains | 0.09% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2689198 |
Product Specific Information
- Target displays homology in the following species:
- Human: 79%
- Rat: 85%
- Peptide sequence: FNGPSVIRRNARERNRVKQVNNGFSQLRQHIPAAVIADLSNGRRGIGPGA
- For short-term use: store at 2–8°C up to 1 week
- For long-term storage: store at -20°C in small aliquots to prevent freeze-thaw cycles
- Concentration is batch dependent: 0.5–1 mg/mL
Target Information
AS-C proteins are involved in the determination of neuronal precursors in the peripheral and central nervous systems.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 파일: PA5-69771_ac_P10083-1_Rabbit.svg, PA5-69771_ac_P10083-1_Rabbit_PDP.jpeg)
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific MYCNOS Polyclonal Antibody642,300원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific PHF23 Polyclonal Antibody642,300원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific FANK1 Polyclonal Antibody642,300원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific PHF22 Polyclonal Antibody642,300원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.