CacheBy
Atlas Antibodies Anti-ART1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ART1 Antibody

상품 한눈에 보기

인간 ART1 단백질을 표적으로 하는 폴리클로날 항체. 면역조직화학(IHC)에 추천. 토끼 숙주에서 생산된 IgG 항체로, PrEST 항원 기반 친화 정제. 인간에 대한 반응성이 검증된 고품질 연구용 시약.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051148-100 Anti-ART1 Antibody, ADP-ribosyltransferase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051148-25 Anti-ART1 Antibody, ADP-ribosyltransferase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ART1 Antibody

Anti-ART1 Antibody

Target Information

  • Target Protein: ADP-ribosyltransferase 1
  • Target Gene: ART1
  • Alternative Gene Names: ART2, CD296
  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human ART1.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Antigen Sequence:
    IQLDMALASFDDQYAGCAAAMTAALPDLNHTEFQANQVYADSWTLASSQWQERQARWPEWSLSPTRPSPPPLGFRDEHGVALLAYT

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity (%)
Mouse ENSMUSG00000030996 72%
Rat ENSRNOG00000020251 71%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

제품 이미지

Recommended Application: IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.