
Atlas Antibodies Anti-ARPC5L Antibody
상품 한눈에 보기
Human ARPC5L 단백질을 인식하는 고품질 Rabbit Polyclonal 항체. IHC 등 다양한 응용에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성 제공. Human, Rat, Mouse에 대한 교차 반응 확인됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ARPC5L Antibody
Target: actin related protein 2/3 complex, subunit 5-like
Supplier: Atlas Antibodies
Recommended Applications
면역조직화학 (IHC)
Product Description
Polyclonal antibody against Human ARPC5L.
Alternative Gene Names
ARC16-2, MGC3038
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | actin related protein 2/3 complex, subunit 5-like |
| Target Gene | ARPC5L |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | NFKSSEIEQAVQSLDRNGVDLLMKYIYKGFEKPTENSSAVLLQWHEKALAVGGLGSIIRVLTARKTV |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000014317 | 99% |
| Mouse | ENSMUSG00000026755 | 99% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 성분 | 농도 및 조건 |
|---|---|
| Glycerol | 40% |
| PBS | pH 7.2 |
| Sodium Azide | 0.02% (preservative) |
| 참고 | Material Safety Data Sheet |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용에 대한 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ARR3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ARPP19 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ARPC5L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ARPIN Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ARPIN Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.