
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ARPC5L Antibody
상품 한눈에 보기
Human ARPC5L 단백질을 인식하는 고품질 Rabbit Polyclonal 항체. IHC 등 다양한 응용에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성 제공. Human, Rat, Mouse에 대한 교차 반응 확인됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA022013-100 Anti-ARPC5L Antibody, actin related protein 2/3 complex, subunit 5-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA022013-25 Anti-ARPC5L Antibody, actin related protein 2/3 complex, subunit 5-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ARPC5L Antibody
Anti-ARPC5L Antibody
Target: actin related protein 2/3 complex, subunit 5-like
Supplier: Atlas Antibodies
Recommended Applications
면역조직화학 (IHC)
Product Description
Polyclonal antibody against Human ARPC5L.
Alternative Gene Names
ARC16-2, MGC3038
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | actin related protein 2/3 complex, subunit 5-like |
| Target Gene | ARPC5L |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | NFKSSEIEQAVQSLDRNGVDLLMKYIYKGFEKPTENSSAVLLQWHEKALAVGGLGSIIRVLTARKTV |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000014317 | 99% |
| Mouse | ENSMUSG00000026755 | 99% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 성분 | 농도 및 조건 |
|---|---|
| Glycerol | 40% |
| PBS | pH 7.2 |
| Sodium Azide | 0.02% (preservative) |
| 참고 | Material Safety Data Sheet |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용에 대한 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



