
Atlas Antibodies Anti-ARNT Antibody
Human ARNT 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 등 다양한 응용에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증되었으며, Rabbit 유래 IgG 형식으로 높은 특이성과 재현성을 제공합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ARNT Antibody
aryl hydrocarbon receptor nuclear translocator
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human ARNT
Alternative Gene Names
bHLHe2, HIF-1beta
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | aryl hydrocarbon receptor nuclear translocator |
| Target Gene | ARNT |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Homology | Rat ENSRNOG00000031174 (83%), Mouse ENSMUSG00000015522 (82%) |
Antigen Sequence:
RFSCLRPRVAGTTEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFLRCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMV
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ARPC1A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ARNTL Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ARNT Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ARNTL2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ARNT2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|