
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ARL6IP6 Antibody
상품 한눈에 보기
인간 ARL6IP6 단백질을 인식하는 토끼 유래 다클론 항체로, IHC, WB, ICC 등 다양한 응용에 적합. 정제된 PrEST 항원 기반 친화 정제 방식으로 높은 특이성과 재현성 제공. Orthogonal 및 Recombinant Expression 검증 완료.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA014743-100 Anti-ARL6IP6 Antibody, ADP-ribosylation factor-like 6 interacting protein 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA014743-25 Anti-ARL6IP6 Antibody, ADP-ribosylation factor-like 6 interacting protein 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ARL6IP6 Antibody
Anti-ARL6IP6 Antibody
ADP-ribosylation factor-like 6 interacting protein 6
Recommended Applications
IHC Orthogonal Validation
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB Recombinant Expression Validation
Recombinant expression validation in WB using target protein overexpression.ICC (Immunocytochemistry)
Suitable for immunocytochemical analysis.
Product Description
Polyclonal Antibody against Human ARL6IP6
Alternative Gene Names
- MGC33864
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ADP-ribosylation factor-like 6 interacting protein 6 |
| Target Gene | ARL6IP6 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | MSFAESGWRSALRRRGPGTPGPVARPSYSSFTQGDSWGEGEVDEEEGCDQVARDLRAEFSAGAWSEPRKRSVLPPDGNGSPVLPDKRNGIFP |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000026960 (72%), Rat ENSRNOG00000005074 (67%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



