
Atlas Antibodies Anti-ARL6IP6 Antibody
인간 ARL6IP6 단백질을 인식하는 토끼 유래 다클론 항체로, IHC, WB, ICC 등 다양한 응용에 적합. 정제된 PrEST 항원 기반 친화 정제 방식으로 높은 특이성과 재현성 제공. Orthogonal 및 Recombinant Expression 검증 완료.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ARL6IP6 Antibody
ADP-ribosylation factor-like 6 interacting protein 6
Recommended Applications
IHC Orthogonal Validation
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB Recombinant Expression Validation
Recombinant expression validation in WB using target protein overexpression.ICC (Immunocytochemistry)
Suitable for immunocytochemical analysis.
Product Description
Polyclonal Antibody against Human ARL6IP6
Alternative Gene Names
- MGC33864
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ADP-ribosylation factor-like 6 interacting protein 6 |
| Target Gene | ARL6IP6 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | MSFAESGWRSALRRRGPGTPGPVARPSYSSFTQGDSWGEGEVDEEEGCDQVARDLRAEFSAGAWSEPRKRSVLPPDGNGSPVLPDKRNGIFP |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000026960 (72%), Rat ENSRNOG00000005074 (67%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ARL9 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ARL8A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ARL6IP6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ARL8A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ARL6IP5 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|