
Atlas Antibodies Anti-ARHGAP4 Antibody
상품 한눈에 보기
인체 ARHGAP4 단백질을 인식하는 고품질 폴리클로날 항체. IHC 및 Western blot에 적합하며, RNA-seq 데이터와 비교한 정교한 오쏘고날 검증 제공. 토끼 유래 IgG 항체로 높은 특이성과 재현성 확보.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ARHGAP4 Antibody
Rho GTPase activating protein 4
Recommended Applications
- IHC (Orthogonal validation): 단백질 발현을 RNA-seq 데이터와 비교하여 고발현 및 저발현 조직에서 검증
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. - Western Blot (WB)
Product Description
Polyclonal Antibody against Human ARHGAP4
Alternative Gene Names
C1, KIAA0131, p115, RhoGAP4, SrGAP4
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Rho GTPase activating protein 4 |
| Target Gene | ARHGAP4 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Information | Rat ENSRNOG00000058545 (72%), Mouse ENSMUSG00000031389 (70%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Antigen Sequence
EHNGMRGLIPHKYITLPAGTEKQVVGAGLQTAGESGSSPEGLLASELVHRPEPCTSPEAMGPSGHRRRCLVPASPEQHVEVDKAVAQNMDSVFKELLGKTSVRQGLGPASTTSP제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ARHGAP36 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ARHGAP40 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ARHGAP4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ARHGAP40 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ARHGAP45 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.