
Atlas Antibodies Anti-ARHGAP24 Antibody
인간 ARHGAP24 단백질을 인식하는 토끼 폴리클로날 항체. Rho GTPase 활성화 단백질 24 검출용으로 적합. IHC 등 다양한 연구 응용 가능. PrEST 항원을 이용해 특이적으로 정제됨. PBS와 글리세롤 버퍼에 보존제 포함.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ARHGAP24 Antibody
Rho GTPase activating protein 24
Recommended Applications
면역조직화학 (IHC)
Product Description
Polyclonal antibody against Human ARHGAP24.
Alternative Gene Names
DKFZP564B1162, FilGAP, FLJ33877
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Rho GTPase activating protein 24 |
| Target Gene | ARHGAP24 |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat (90%), Mouse (88%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
Antigen Information
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
ILNSDTLGNPTNVRNMSWLPNGYVTLRDNKQKEQAGELGQHNRLSTYDNVHQQFSMMNLDDKQSIDSATWSTSSCEISLPENSNSCRSSTTTCPEQDFFGGNFEDPVLDGPPQDDLSHPRDYESKSD
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ARHGAP26 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ARHGAP25 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ARHGAP24 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ARHGAP26 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ARHGAP28 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|