
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-APPL1 Antibody
상품 한눈에 보기
Human APPL1 단백질을 인식하는 토끼 폴리클로날 항체로, adaptor protein 연구용. IHC 등 다양한 응용 가능. 고순도 Affinity 정제 방식으로 제조. 40% 글리세롤 PBS 버퍼에 보존.
- 카탈로그번호
- HPA073477-xxx (2개 옵션)
- 카테고리
- Antibodies
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA073477-100 Anti-APPL1 Antibody, adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA073477-25 Anti-APPL1 Antibody, adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-APPL1 Antibody
Anti-APPL1 Antibody
Adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 1
Recommended Applications
면역조직화학(IHC) 등 다양한 연구용 응용에 적합
Product Description
Polyclonal Antibody against Human APPL1
Alternative Gene Names
APPL
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 1 |
| Target Gene | APPL1 |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000040760 (98%), Rat ENSRNOG00000013574 (96%) |
Antigen Information
| 항목 | 내용 |
|---|---|
| Antigen Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | VTRLTFPLPCVVLYATHQENKRLFGFVLRTSSGRSESNLSSVCYIFESNNEGEKICDSVGLAKQIALHAELDRRASEKQKEIERVKEKQQKELNKQKQIEKDLEEQ |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



