Atlas Antibodies Anti-APEH Antibody

상품 한눈에 보기

Human APEH 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합함. Orthogonal 및 Independent validation으로 신뢰성 검증 완료. Rabbit 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제됨.

카탈로그번호: HPA029702-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Primary Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA029702-100 Anti-APEH Antibody, acylaminoacyl-peptide hydrolase 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA029702-25 Anti-APEH Antibody, acylaminoacyl-peptide hydrolase 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-APEH Antibody

Anti-APEH Antibody

acylaminoacyl-peptide hydrolase

Recommended Applications

IHC Orthogonal Validation
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB Independent Validation
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
ICC Application
Suitable for immunocytochemistry (ICC) assays.

Product Description

Polyclonal Antibody against Human APEH

Alternative Gene Names

D3F15S2, D3S48E, DNF15S2

Open Datasheet

Target Information

항목	내용
Target Protein	acylaminoacyl-peptide hydrolase
Target Gene	APEH
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: IDQDLMVAQFSTPSLPPTLKVGFLPSAGKEQSVLWVSLEEAEPIPDIHWGIRVLQPPPEQENVQYAGLDFEAILLQPGSPPDKTQVP
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000032590 (86%) Rat ENSRNOG00000029572 (86%)

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.