
Atlas Antibodies Anti-APEH Antibody
상품 한눈에 보기
Human APEH 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합함. Orthogonal 및 Independent validation으로 신뢰성 검증 완료. Rabbit 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-APEH Antibody
acylaminoacyl-peptide hydrolase
Recommended Applications
IHC Orthogonal Validation
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB Independent Validation
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.ICC Application
Suitable for immunocytochemistry (ICC) assays.
Product Description
Polyclonal Antibody against Human APEH
Alternative Gene Names
D3F15S2, D3S48E, DNF15S2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | acylaminoacyl-peptide hydrolase |
| Target Gene | APEH |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: IDQDLMVAQFSTPSLPPTLKVGFLPSAGKEQSVLWVSLEEAEPIPDIHWGIRVLQPPPEQENVQYAGLDFEAILLQPGSPPDKTQVP |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000032590 (86%) Rat ENSRNOG00000029572 (86%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
