
Atlas Antibodies Anti-ANXA10 Antibody
상품 한눈에 보기
Human ANXA10 단백질을 표적으로 하는 폴리클로날 항체. Rabbit 호스트에서 생산되었으며, IHC 및 Western blot에 적합. Orthogonal validation을 통해 RNA-seq 데이터와 단백질 발현 비교 검증 완료. 고순도 Affinity purification 방식으로 정제됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ANXA10 Antibody
Target Protein: annexin A10
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC) – Orthogonal validation of protein expression using comparison to RNA-seq data in high and low expression tissues
- Western Blot (WB)
Product Description
Polyclonal antibody against Human ANXA10.
Alternative Gene Names
- ANX14
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | annexin A10 |
| Target Gene | ANXA10 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | PPLYDAHELWHAMKGVGTDENCLIEILASRTNGEIFQMREAYCLQYSNNLQEDIYSETSGHFRDTLMNLVQGTREEGYTDPAMAAQDAMVLWEACQQKTGEHKTMLQMILCNK |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000014339 (97%), Mouse ENSMUSG00000031635 (95%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ANXA11 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ANXA1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ANXA10 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ANXA13 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ANXA10 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.