Thermo Fisher Scientific GDF9 (Growth Differentiation Factor 9) Monoclonal Antibody (GDF9/4261)
GDF9 단백질을 인식하는 Mouse IgG1 단일클론 항체로, 인간 시료에 반응합니다. Western blot, IHC, ELISA 등 다양한 응용에 사용 가능하며, 단백질 A/G로 정제된 액상 형태입니다. 연구용으로만 사용되며 4°C에서 보관합니다.
- 판매단위
- pk
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific GDF9 (Growth Differentiation Factor 9) Monoclonal Antibody (GDF9/4261)
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1–2 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | Assay-dependent |
| Immunohistochemistry (PFA fixed) (IHC (PFA)) | 1–2 µg/mL |
| ELISA | Assay-dependent |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Clone | GDF9/4261 |
| Immunogen | Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC recognizing an epitope with the EPDG sequence near the C-terminal region of human GDF9 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 200 µg/mL |
| Purification | Protein A/G |
| Storage Buffer | PBS, pH 7.4, with 0.05% BSA |
| Contains | 0.05% sodium azide |
| Storage Conditions | 4°C, do not freeze |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
Target Information
GDF9 is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. These proteins feature a polybasic proteolytic processing site that is cleaved to produce a mature protein with seven conserved cysteine residues. Members of this family regulate cell growth and differentiation in both embryonic and adult tissues. Growth factors synthesized by ovarian somatic cells directly influence oocyte growth and function. GDF9 is expressed in oocytes and is essential for ovarian folliculogenesis.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.