Thermo Fisher Scientific GDF9 (Growth Differentiation Factor 9) Monoclonal Antibody (GDF9/4261)
GDF9 단백질을 인식하는 Mouse IgG1 단일클론 항체로, 인간 시료에 반응합니다. Western blot, IHC, ELISA 등 다양한 응용에 사용 가능하며, 단백질 A/G로 정제된 액상 형태입니다. 연구용으로만 사용되며 4°C에서 보관합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1–2 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | Assay-dependent |
| Immunohistochemistry (PFA fixed) (IHC (PFA)) | 1–2 µg/mL |
| ELISA | Assay-dependent |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Clone | GDF9/4261 |
| Immunogen | Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC recognizing an epitope with the EPDG sequence near the C-terminal region of human GDF9 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 200 µg/mL |
| Purification | Protein A/G |
| Storage Buffer | PBS, pH 7.4, with 0.05% BSA |
| Contains | 0.05% sodium azide |
| Storage Conditions | 4°C, do not freeze |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
Target Information
GDF9 is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. These proteins feature a polybasic proteolytic processing site that is cleaved to produce a mature protein with seven conserved cysteine residues. Members of this family regulate cell growth and differentiation in both embryonic and adult tissues. Growth factors synthesized by ovarian somatic cells directly influence oocyte growth and function. GDF9 is expressed in oocytes and is essential for ovarian folliculogenesis.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific GDF8 (Growth Differentiation Factor 8)/Myostatin Monoclonal Antibody (GDF9/4261)
449,700원
Thermo Fisher Scientific
Thermo Fisher Scientific GDF8 (Growth Differentiation Factor 8)/Myostatin Monoclonal Antibody (GDF9/4261)
900,300원
Thermo Fisher Scientific
Thermo Fisher Scientific GDF9 (Growth Differentiation Factor 9) Monoclonal Antibody (GDF9/4261)
449,700원
Thermo Fisher Scientific
Thermo Fisher Scientific Nalgene Polypropylene, End Caps, tri
97,300원
Thermo Fisher Scientific
Thermo Fisher Scientific Nalgene PVDF True Union Clamps, 0.75 inch
75,600원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|