Thermo Fisher Scientific RHOA Monoclonal Antibody (1A11)

Applications

Western Blot (WB)

• Tested Dilution: 1–5 µg/mL

ELISA

• Tested Dilution: 3 ng/mL

Product Specifications

Product Specific Information

Sequence of this protein is as follows:
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTD VILMCFSIDSPDSLENIPEKWTP EVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL

Target Information

RhoA regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. It is involved in a microtubule-dependent signal required for myosin contractile ring formation during cytokinesis and plays an essential role in cleavage furrow formation.
RhoA is also required for apical junction formation of keratinocyte cell-cell adhesion and serves as a target for the yopT cysteine peptidase from Yersinia pestis and Yersinia pseudotuberculosis.
It stimulates PKN2 kinase activity and may activate PLCE1. Activated by ARHGEF2, RhoA promotes GDP-GTP exchange and is essential for SPATA13-mediated regulation of cell migration and adhesion.
The MEMO1–RHOA–DIAPH1 signaling pathway is important for ERBB2-dependent microtubule stabilization at the cell cortex, controlling APC and CLASP2 localization via GSK3B regulation. Membrane-bound APC allows MACF1 localization necessary for microtubule capture and stabilization.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.