Thermo Fisher Scientific RHOA Monoclonal Antibody (1A11)
RHOA 단백질을 인식하는 Mouse IgG1 단클론 항체로, Western blot 및 ELISA에 적합합니다. Human 종에 반응하며, PBS buffer에 보존된 액상 형태입니다. 세포 신호전달 및 세포골격 연구에 활용됩니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific RHOA Monoclonal Antibody (1A11)
Applications
Western Blot (WB)
- Tested Dilution: 1–5 µg/mL
ELISA
- Tested Dilution: 3 ng/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Mouse / IgG1, lambda |
| Class | Monoclonal |
| Type | Antibody |
| Clone | 1A11 |
| Immunogen | RHOA (AAH01360, 1–193 a.a.) full-length recombinant protein with GST tag (MW of GST tag: 26 kDa) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | See Label |
| Purification | Affinity chromatography |
| Storage Buffer | PBS, pH 7.4 |
| Contains | No preservative |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
Product Specific Information
Sequence of this protein is as follows:
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTD VILMCFSIDSPDSLENIPEKWTP EVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL
Target Information
RhoA regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. It is involved in a microtubule-dependent signal required for myosin contractile ring formation during cytokinesis and plays an essential role in cleavage furrow formation.
RhoA is also required for apical junction formation of keratinocyte cell-cell adhesion and serves as a target for the yopT cysteine peptidase from Yersinia pestis and Yersinia pseudotuberculosis.
It stimulates PKN2 kinase activity and may activate PLCE1. Activated by ARHGEF2, RhoA promotes GDP-GTP exchange and is essential for SPATA13-mediated regulation of cell migration and adhesion.
The MEMO1–RHOA–DIAPH1 signaling pathway is important for ERBB2-dependent microtubule stabilization at the cell cortex, controlling APC and CLASP2 localization via GSK3B regulation. Membrane-bound APC allows MACF1 localization necessary for microtubule capture and stabilization.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.