Thermo Fisher Scientific PIGN Polyclonal Antibody
Human PIGN 단백질을 인식하는 Rabbit Polyclonal Antibody로, IHC(P) 및 ICC/IF에 사용 가능. 항원 친화 크로마토그래피로 정제된 액상 형태이며, PBS/glycerol buffer에 보존. GPI-anchor 생합성 연구용으로 적합.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific PIGN Polyclonal Antibody
Applications
Immunohistochemistry (Paraffin) (IHC (P))
- Tested Dilution: 1:50–1:200
Immunocytochemistry (ICC/IF)
- Tested Dilution: 0.25–2 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant protein corresponding to Human PIGN. Recombinant protein control fragment (Product #RP-98291) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.4 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS, pH 7.2, with 40% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping Conditions | Wet ice |
| RRID | AB_2645549 |
Product Specific Information
Immunogen sequence:
SWGISHTRVPTESRPGHVALIAGFYEDVSAVAKGWKENPVEFDSLFNESKYTWSWGSPDILPMFAKGASGDHVYTYSYDAKREDFGAQDATKLDTW
Highest antigen sequence identity to the following orthologs:
- Mouse: 97%
- Rat: 97%
Target Information
PIGN is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis.
The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface.
This protein is expressed in the endoplasmic reticulum and transfers phosphoethanolamine (EtNP) to the first mannose of the GPI anchor.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.