Thermo Fisher Scientific PIGN Polyclonal Antibody
Human PIGN 단백질을 인식하는 Rabbit Polyclonal Antibody로, IHC(P) 및 ICC/IF에 사용 가능. 항원 친화 크로마토그래피로 정제된 액상 형태이며, PBS/glycerol buffer에 보존. GPI-anchor 생합성 연구용으로 적합.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Immunohistochemistry (Paraffin) (IHC (P))
- Tested Dilution: 1:50–1:200
Immunocytochemistry (ICC/IF)
- Tested Dilution: 0.25–2 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant protein corresponding to Human PIGN. Recombinant protein control fragment (Product #RP-98291) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.4 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS, pH 7.2, with 40% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping Conditions | Wet ice |
| RRID | AB_2645549 |
Product Specific Information
Immunogen sequence:
SWGISHTRVPTESRPGHVALIAGFYEDVSAVAKGWKENPVEFDSLFNESKYTWSWGSPDILPMFAKGASGDHVYTYSYDAKREDFGAQDATKLDTW
Highest antigen sequence identity to the following orthologs:
- Mouse: 97%
- Rat: 97%
Target Information
PIGN is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis.
The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface.
This protein is expressed in the endoplasmic reticulum and transfers phosphoethanolamine (EtNP) to the first mannose of the GPI anchor.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific SLC46A3 Polyclonal Antibody
773,300원
Thermo Fisher Scientific
Thermo Fisher Scientific MRPL51 Polyclonal Antibody
773,300원
Thermo Fisher Scientific
Thermo Fisher Scientific PIGN Polyclonal Antibody
791,000원
Thermo Fisher Scientific
Thermo Fisher Scientific ANKRD42 Polyclonal Antibody
773,300원
Thermo Fisher Scientific
Thermo Fisher Scientific TREH Polyclonal Antibody
796,700원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|