CacheBy
Thermo Fisher Scientific PIGN Polyclonal Antibody
원본

Thermo Fisher Scientific PIGN Polyclonal Antibody

상품 한눈에 보기

Human PIGN 단백질을 인식하는 Rabbit Polyclonal Antibody로, IHC(P) 및 ICC/IF에 사용 가능. 항원 친화 크로마토그래피로 정제된 액상 형태이며, PBS/glycerol buffer에 보존. GPI-anchor 생합성 연구용으로 적합.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 07. 03. 오후 06:55
Thermo Fisher Scientific PA558987 PIGN Polyclonal Antibody 100 ul pk판매 단위 pk ·
재고 확인 필요
791,000원VAT 포함 870,100원

Thermo Fisher Scientific · Thermo Fisher Scientific PIGN Polyclonal Antibody

Applications

Immunohistochemistry (Paraffin) (IHC (P))

  • Tested Dilution: 1:50–1:200

Immunocytochemistry (ICC/IF)

  • Tested Dilution: 0.25–2 µg/mL

Product Specifications

항목 내용
Species Reactivity Human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen Recombinant protein corresponding to Human PIGN. Recombinant protein control fragment (Product #RP-98291)
Conjugate Unconjugated
Form Liquid
Concentration 0.4 mg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS, pH 7.2, with 40% glycerol
Contains 0.02% sodium azide
Storage Conditions Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Shipping Conditions Wet ice
RRID AB_2645549

Product Specific Information

Immunogen sequence:
SWGISHTRVPTESRPGHVALIAGFYEDVSAVAKGWKENPVEFDSLFNESKYTWSWGSPDILPMFAKGASGDHVYTYSYDAKREDFGAQDATKLDTW

Highest antigen sequence identity to the following orthologs:

  • Mouse: 97%
  • Rat: 97%

Target Information

PIGN is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis.
The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface.
This protein is expressed in the endoplasmic reticulum and transfers phosphoethanolamine (EtNP) to the first mannose of the GPI anchor.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.