CacheBy
Atlas Antibodies Anti-MRPL18 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MRPL18 Antibody

상품 한눈에 보기

인간 MRPL18 단백질을 표적으로 하는 고품질 폴리클로날 항체. IHC 및 WB 응용에 적합하며, 독립 항체 비교를 통한 단백질 발현 검증 완료. 토끼 유래 IgG, PrEST 항원 기반 친화 정제.

카탈로그번호
HPA028775-xxx (2개 옵션)
카테고리
Primary Antibodies
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA028775-100 Anti-MRPL18 Antibody, mitochondrial ribosomal protein L18 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028775-25 Anti-MRPL18 Antibody, mitochondrial ribosomal protein L18 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MRPL18 Antibody

Anti-MRPL18 Antibody

Target: mitochondrial ribosomal protein L18
Supplier: Atlas Antibodies


  • IHC (Independent validation): Validation of protein expression in immunohistochemistry by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Western Blot)

Product Description

Polyclonal antibody against Human MRPL18


Alternative Gene Names

  • HSPC071

Open Datasheet


Target Information

항목 내용
Target Protein mitochondrial ribosomal protein L18
Target Gene MRPL18
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000057388 (77%)
Rat ENSRNOG00000014582 (75%)

Antigen Sequence:

MALRSRFWGLFSVCRNPGCRFAALSTSSEPAAKPEVDPVENEAVAPEFTNRNPRNLELLSVARKERGWRTVFPSREFWHRLRVIRTQHHVEA

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
Independent Validation Tooltip
Western Blot

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.