
Atlas Antibodies Anti-MRPL15 Antibody
상품 한눈에 보기
Human MRPL15 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 분석에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 단백질 발현을 비교 검증하였습니다. 고순도 Affinity 정제 항체로 사람, 마우스, 랫트에 반응합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MRPL15 Antibody
Target: mitochondrial ribosomal protein L15 (MRPL15)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation): 단백질 발현을 RNA-seq 데이터와 비교하여 검증
- WB (Western Blot)
Product Description
Polyclonal antibody against Human MRPL15
Alternative Gene Names:
HSPC145, L15mt, MRP-L15, MRP-L7, RPML7
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | mitochondrial ribosomal protein L15 |
| Target Gene | MRPL15 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | LRGQPIPKRMLPPEELVPYYTDAKNRGYLADPAKFPEARLELARKYGYILPDITKDELFKMLCTRKDPRQIFFGLAPGWVVNMADKKILKPTDEN |
Verified Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information:
Highest antigen sequence identity to orthologs:
- Mouse ENSMUSG00000033845 (93%)
- Rat ENSRNOG00000008566 (93%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 맞는 최적의 농도와 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MRPL17 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MRPL16 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MRPL15 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MRPL14 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MRPL14 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.