
Atlas Antibodies Anti-MRO Antibody
상품 한눈에 보기
Human MRO 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB(Recombinant Expression) 검증 완료. PrEST 항원 기반 친화 정제 방식으로 높은 특이성과 재현성을 제공. Human에서 검증되었으며 Mouse, Rat와 교차 반응 가능성 있음.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MRO Antibody
Supplier: Atlas Antibodies
Product Type: Polyclonal Antibody against Human MRO
Gene Symbol: MRO (maestro)
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Recombinant Expression Validation)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody raised in rabbit against Human MRO protein. Validated for use in IHC and WB applications.
Alternative Gene Names
B29, C18orf3, FLJ30140
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | maestro |
| Target Gene | MRO |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | DDENDSLRYSAFVLFGQLAAFAGRKWKKFFTSQVKQTRDSLLIHLQDRNPQVAKACKTTFQACSPYLKLKEEYSFQSEEDQRNTKLYQQLSHYHPEILQFFYANKIL |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000024426 (78%), Mouse ENSMUSG00000064036 (74%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
