Atlas Antibodies Anti-MRI1 Antibody
상품 한눈에 보기
Human MRI1 단백질을 인식하는 Rabbit Polyclonal 항체로, WB, IHC, ICC 등 다양한 응용에 적합합니다. PrEST 항원으로 정제되었으며, Orthogonal validation을 통해 단백질 발현이 검증되었습니다. Human에 대한 반응성이 확인되었습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MRI1 Antibody
Target: methylthioribose-1-phosphate isomerase 1 (MRI1)
Type: Polyclonal Antibody against Human MRI1
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Orthogonal validation)
- ICC (Immunocytochemistry)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal antibody targeting human MRI1, validated for multiple applications.
Alternative Gene Names
MGC3207, MRDI, mtnA, Ypr118w
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | methylthioribose-1-phosphate isomerase 1 |
| Target Gene | MRI1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | HGIPFYVAAPSSSCDLRLETGKEIIIEERPGQELTDVNGVRIAAPGIGVWNPAFDVTPHDLITGGIITELGVFAPEELRTALTTTISSRD |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Species | Human |
| Interspecies Identity | Rat ENSRNOG00000026211 (87%), Mouse ENSMUSG00000004996 (82%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.