AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MRI1 Antibody
상품 한눈에 보기
Human MRI1 단백질을 인식하는 Rabbit Polyclonal 항체로, WB, IHC, ICC 등 다양한 응용에 적합합니다. PrEST 항원으로 정제되었으며, Orthogonal validation을 통해 단백질 발현이 검증되었습니다. Human에 대한 반응성이 확인되었습니다.
- 카탈로그번호
- HPA042744-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA042744-100 Anti-MRI1 Antibody, methylthioribose-1-phosphate isomerase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042744-25 Anti-MRI1 Antibody, methylthioribose-1-phosphate isomerase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MRI1 Antibody
Anti-MRI1 Antibody
Target: methylthioribose-1-phosphate isomerase 1 (MRI1)
Type: Polyclonal Antibody against Human MRI1
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Orthogonal validation)
- ICC (Immunocytochemistry)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal antibody targeting human MRI1, validated for multiple applications.
Alternative Gene Names
MGC3207, MRDI, mtnA, Ypr118w
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | methylthioribose-1-phosphate isomerase 1 |
| Target Gene | MRI1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | HGIPFYVAAPSSSCDLRLETGKEIIIEERPGQELTDVNGVRIAAPGIGVWNPAFDVTPHDLITGGIITELGVFAPEELRTALTTTISSRD |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Species | Human |
| Interspecies Identity | Rat ENSRNOG00000026211 (87%), Mouse ENSMUSG00000004996 (82%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.