Atlas Antibodies Anti-MPC1 Antibody

상품 한눈에 보기

인간 MPC1 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 실험에 적합합니다. RNA-seq 데이터 기반 정교한 Orthogonal 검증을 거쳤으며, 토끼 유래 IgG 형태로 정제된 고품질 항체입니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA055790-100 Anti-MPC1 Antibody, mitochondrial pyruvate carrier 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA055790-25 Anti-MPC1 Antibody, mitochondrial pyruvate carrier 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: mitochondrial pyruvate carrier 1 (MPC1)
Supplier: Atlas Antibodies

IHC (Immunohistochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Western Blot)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
ICC (Immunocytochemistry)

Polyclonal Antibody against Human MPC1

BRP44L, CGI-129, dJ68L15.3

항목	내용
Target Protein	mitochondrial pyruvate carrier 1
Target Gene	MPC1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGR
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000023861 (100%), Rat ENSRNOG00000012415 (100%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS	Material Safety Data Sheet