Atlas Antibodies Anti-MPDZ Antibody

상품 한눈에 보기

Human MPDZ 단백질에 대한 폴리클로날 항체로, Rabbit 유래 IgG 형태입니다. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용한 친화 정제 방식으로 고순도 확보. 인간 반응성이 검증된 신뢰성 높은 연구용 항체입니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA020255-100 Anti-MPDZ Antibody, multiple PDZ domain protein 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA020255-25 Anti-MPDZ Antibody, multiple PDZ domain protein 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Polyclonal Antibody against Human MPDZ

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

VVNILKELPIEVTMVCCRRTVPPTTQSELDSLDLCDIELTEKPHVDLGEFIGSSETEDPVLAMTDAGQSTEEVQAPLAMWEAGIQHIELEKGSKGLGFS

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Recommended Applications	Immunohistochemistry (IHC)
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.