Atlas Antibodies Anti-MORF4L1 Antibody

상품 한눈에 보기

Human MORF4L1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합합니다. Eaf3, MEAF3, MRG15 등 다양한 유전자명으로 알려진 단백질 검출에 사용됩니다. 고순도 Affinity Purified 제품으로 높은 특이성과 재현성을 제공합니다.

카탈로그번호: HPA062010-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA062010-100 Anti-MORF4L1 Antibody, mortality factor 4 like 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA062010-25 Anti-MORF4L1 Antibody, mortality factor 4 like 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-MORF4L1 Antibody

Anti-MORF4L1 Antibody

Target Protein: mortality factor 4 like 1 (MORF4L1)
Supplier: Atlas Antibodies

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB)

Product Description

Polyclonal antibody against Human MORF4L1.

Alternative Gene Names

Eaf3, HsT17725, MEAF3, MORFRG15, MRG15

Open Datasheet

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence:
DPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNLQKQRELQ

Verified Species Reactivity

Human
Rat

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

Mouse (ENSMUSG00000062270): 100%
Rat (ENSRNOG00000058412): 99%

Product Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol, PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using PrEST antigen
Storage	Store at recommended temperature; mix gently before use
Notes	Optimal concentrations and conditions should be determined by the user.