
Atlas Antibodies Anti-MORF4L1 Antibody
Human MORF4L1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합합니다. Eaf3, MEAF3, MRG15 등 다양한 유전자명으로 알려진 단백질 검출에 사용됩니다. 고순도 Affinity Purified 제품으로 높은 특이성과 재현성을 제공합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MORF4L1 Antibody
Target Protein: mortality factor 4 like 1 (MORF4L1)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against Human MORF4L1.
Alternative Gene Names
Eaf3, HsT17725, MEAF3, MORFRG15, MRG15
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence:
DPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNLQKQRELQ
Verified Species Reactivity
- Human
- Rat
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000062270): 100%
- Rat (ENSRNOG00000058412): 99%
Product Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol, PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using PrEST antigen |
| Storage | Store at recommended temperature; mix gently before use |
| Notes | Optimal concentrations and conditions should be determined by the user. |
Material Safety Data Sheet (Sodium Azide)
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MOSPD1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MORN1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MORF4L1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MORF4L1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MORC4 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|