Atlas Antibodies Anti-MNS1 Antibody

상품 한눈에 보기

Human MNS1 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. 재조합 발현 검증 완료. Rabbit 유래 IgG 형식으로, PrEST 항원을 이용해 친화 정제됨. Human에 특이적으로 반응하며 높은 교차종 유사성을 가짐.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA040382-100 Anti-MNS1 Antibody, meiosis-specific nuclear structural 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA040382-25 Anti-MNS1 Antibody, meiosis-specific nuclear structural 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: meiosis-specific nuclear structural 1 (MNS1)
Type: Polyclonal Antibody against Human MNS1

IHC (Immunohistochemistry)
WB (Western Blot) – Recombinant expression validation using target protein overexpression
ICC (Immunocytochemistry)

Polyclonal antibody targeting human MNS1 protein, validated for multiple applications.

항목	내용
Target Protein	meiosis-specific nuclear structural 1
Target Gene	MNS1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	AKEEEENFRKTMLAKFAEDDRIELMNAQKQRMKQLEHRRAVEKLIEERRQQFLADKQRELEEWQLQQRRQGFINAIIEEERLKLLKEHATNLLGYLPKGVFKKEDDIDLLGEEFRKVYQQR

Species	Gene ID	Identity
Mouse	ENSMUSG00000032221	87%
Rat	ENSRNOG00000057867	87%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand