
Atlas Antibodies Anti-MMACHC Antibody
상품 한눈에 보기
Human MMACHC 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB(Recombinant Expression) 검증 완료. Rabbit 유래 IgG이며, PrEST 항원으로 친화 정제됨. 인간 반응성 확인 및 마우스·랫과 높은 서열 유사성 보유.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MMACHC Antibody
Target Information
- Target Protein: methylmalonic aciduria (cobalamin deficiency) cblC type, with homocystinuria
- Target Gene: MMACHC
- Alternative Gene Names: cblC, DKFZP564I122
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) – Recombinant Expression Validation
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody against human MMACHC.
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
NFHWRDWTYRDAVTPQERYSEEQKAYFSTPPAQRLALLGLAQPSEKPSSPSPDLPFTTPAPKKPGNPSRARSWLSPRVSPPAS - Verified Species Reactivity: Human
- Interspecies Information:
- Mouse (ENSMUSG00000028690) – 77% identity
- Rat (ENSRNOG00000017233) – 74% identity
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Usage Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
