
Atlas Antibodies Anti-MKLN1 Antibody
상품 한눈에 보기
Human MKLN1 단백질을 인식하는 rabbit polyclonal antibody로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화정제 방식으로 높은 특이성과 재현성을 제공. Human에 반응하며, Mouse 및 Rat과 96% 서열 일치.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MKLN1 Antibody
Target: muskelin 1, intracellular mediator containing kelch motifs
Type: Polyclonal Antibody against Human MKLN1
Recommended Applications
- Immunohistochemistry (IHC) 등 다양한 연구용 응용 가능
Product Description
Polyclonal antibody raised in rabbit against Human MKLN1 (muskelin 1), an intracellular mediator containing kelch motifs.
Alternative Gene Names
- TWA2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | muskelin 1, intracellular mediator containing kelch motifs |
| Target Gene | MKLN1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | QAAKDNPTKSLQEEEPCPRFAHQLVYDELHKVHYLFGGNPGKSCSPKMRLDDFWSLKLCRPSKDYLLRHCKYLIRKHRFEEKAQVDPLSALKYLQNDLYITVDHSDP |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000025609 (96%), Rat ENSRNOG00000054514 (96%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 사용 농도 및 조건은 실험자가 직접 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MKRN2OS Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MKNK1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MKLN1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MKLN1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MKL1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.