CacheBy
Atlas Antibodies Anti-MIPEP Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MIPEP Antibody

상품 한눈에 보기

인간 MIPEP 단백질을 인식하는 토끼 폴리클로날 항체로, 미토콘드리아 중간 펩티다아제 연구에 적합합니다. IHC 및 ICC 응용에 권장되며, PrEST 항원으로 친화 정제되었습니다. 인간에 대해 검증된 반응성을 보입니다.

카탈로그번호
HPA030676-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030676-100 Anti-MIPEP Antibody, mitochondrial intermediate peptidase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030676-25 Anti-MIPEP Antibody, mitochondrial intermediate peptidase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MIPEP Antibody

Anti-MIPEP Antibody

Overview

Polyclonal antibody against human MIPEP (mitochondrial intermediate peptidase).

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

This polyclonal antibody targets the human mitochondrial intermediate peptidase (MIPEP) and is affinity purified using the PrEST antigen as an affinity ligand.

Alternative Gene Names

  • MIP

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein Mitochondrial intermediate peptidase
Target Gene MIPEP
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence LRFSHLVGYGARYYSYLMSRAVASMVWKECFLQDPFNRAAGERYRREMLAHGGGREPMLMVEGMLQKCPSVDDFVSALVSDLDLDFETFLMDS

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat (ENSRNOG00000013876): 91%
  • Mouse (ENSMUSG00000021993): 88%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.