
Atlas Antibodies Anti-MICU3 Antibody
상품 한눈에 보기
Human MICU3 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 Western Blot에 적합합니다. PrEST 항원을 이용해 Affinity 정제되었으며, 고순도의 IgG 포맷으로 제공됩니다. Human에 반응하며, Mouse 및 Rat과 높은 서열 유사성을 가집니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MICU3 Antibody
Target: Mitochondrial calcium uptake family, member 3 (MICU3)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against human MICU3.
Alternative Gene Names
- DKFZp313A0139
- EFHA2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Mitochondrial calcium uptake family, member 3 |
| Target Gene | MICU3 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | RIAFNMFDTDGNEMVDKKEFLVLQEIFRKKNEKREIKGDEEKRAMLRLQLYGYHSPTNSVLKTDAEELVSRS |
Species Reactivity
- Verified Species: Human
- Ortholog Sequence Identity:
- Mouse (ENSMUSG00000039478): 97%
- Rat (ENSRNOG00000012767): 65%
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide added as preservative
- Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MICU1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MIEF2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MICU3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MIDN Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MID1IP1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.