
Atlas Antibodies Anti-MIEN1 Antibody
상품 한눈에 보기
Human MIEN1 단백질을 인식하는 토끼 폴리클로날 항체. IHC 등 다양한 응용에 적합. 고순도 Affinity 정제 방식으로 제조. MIEN1 관련 연구 및 암 전이 기전 연구에 활용 가능.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MIEN1 Antibody
Target: migration and invasion enhancer 1 (MIEN1)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human MIEN1 protein.
Recommended for use in immunohistochemistry (IHC) and related applications.
Alternative Gene Names
C17orf37, C35, MGC14832, ORB3, Rdx12, XTP4
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
GTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRP - Verified Species Reactivity: Human
- Interspecies Identity:
- Rat ENSRNOG00000007227 (96%)
- Mouse ENSMUSG00000002580 (94%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Storage | Store at -20°C or below. Avoid repeated freeze-thaw cycles. |
| Safety | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal dilution and conditions should be determined by the end user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MIDN Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MID1IP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MIEN1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MICU2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MIDN Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.