Atlas Antibodies Anti-MIEN1 Antibody

상품 한눈에 보기

Human MIEN1 단백질을 인식하는 토끼 폴리클로날 항체. IHC 등 다양한 응용에 적합. 고순도 Affinity 정제 방식으로 제조. MIEN1 관련 연구 및 암 전이 기전 연구에 활용 가능.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA061344-100 Anti-MIEN1 Antibody, migration and invasion enhancer 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA061344-25 Anti-MIEN1 Antibody, migration and invasion enhancer 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: migration and invasion enhancer 1 (MIEN1)
Supplier: Atlas Antibodies

Polyclonal antibody against human MIEN1 protein.
Recommended for use in immunohistochemistry (IHC) and related applications.

C17orf37, C35, MGC14832, ORB3, Rdx12, XTP4

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
```
GTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRP
```
Verified Species Reactivity: Human
Interspecies Identity:
- Rat ENSRNOG00000007227 (96%)
- Mouse ENSMUSG00000002580 (94%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Storage	Store at -20°C or below. Avoid repeated freeze-thaw cycles.
Safety	Material Safety Data Sheet