CacheBy
Atlas Antibodies Anti-METTL27 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-METTL27 Antibody

상품 한눈에 보기

Human METTL27 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity purification 방식으로 정제됨. ICC 등 다양한 응용에 적합하며, WBSCR27 유전자 대체명으로도 알려짐. 40% glycerol 기반 PBS 버퍼에 보존되어 안정적 사용 가능.

카탈로그번호
HPA074662-xxx (2개 옵션)
카테고리
Primary Antibodies
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA074662-100 Anti-METTL27 Antibody, methyltransferase like 27 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA074662-25 Anti-METTL27 Antibody, methyltransferase like 27 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-METTL27 Antibody

Anti-METTL27 Antibody

Overview

Polyclonal antibody against human methyltransferase like 27 (METTL27), also known as WBSCR27.

  • Immunocytochemistry (ICC)

Product Description

This antibody is a polyclonal IgG raised in rabbit, affinity purified using the PrEST antigen as the affinity ligand.

Target Information

항목 내용
Target Protein methyltransferase like 27
Target Gene METTL27
Alternative Gene Name WBSCR27
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence RAPGFLQLHGVDGSPGMLEQAQAPGLYQRLSLCTLGQEPLPSPEGTFDAVLIVGALSDGQVPCNAIPEL
Verified Species Reactivity Human
Interspecies Identity Mouse (80%), Rat (78%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen

Buffer Composition

성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.