
Atlas Antibodies Anti-MESDC2 Antibody
상품 한눈에 보기
Human MESDC2 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 IHC 분석에 적합합니다. PrEST 항원으로 정제되었으며 높은 특이성과 재현성을 제공합니다. MESDC2 단백질 발현 검증 및 연구용으로 사용됩니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MESDC2 Antibody
Target: mesoderm development candidate 2 (MESDC2)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Independent Validation:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human MESDC2
Alternative Gene Names
BOCA, KIAA0081, MESD
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | mesoderm development candidate 2 |
| Target Gene | MESDC2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000012366 (89%), Mouse ENSMUSG00000038503 (88%) |
Antigen Sequence:
SLFNANYDVQRFIVGSDRAIFMLRDGSYAWEIKDFLVGQDRCADVTLEGQVYPGKGGGSKEKNKTKQDKGKKKKEGDLKSRSSK
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MEST Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MESP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MESDC2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MESDC2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MESDC1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.