
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MESDC2 Antibody
상품 한눈에 보기
Human MESDC2 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 IHC 분석에 적합합니다. PrEST 항원으로 정제되었으며 높은 특이성과 재현성을 제공합니다. MESDC2 단백질 발현 검증 및 연구용으로 사용됩니다.
- 카탈로그번호
- HPA041721-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA041721-100 Anti-MESDC2 Antibody, mesoderm development candidate 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041721-25 Anti-MESDC2 Antibody, mesoderm development candidate 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MESDC2 Antibody
Anti-MESDC2 Antibody
Target: mesoderm development candidate 2 (MESDC2)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Independent Validation:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human MESDC2
Alternative Gene Names
BOCA, KIAA0081, MESD
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | mesoderm development candidate 2 |
| Target Gene | MESDC2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000012366 (89%), Mouse ENSMUSG00000038503 (88%) |
Antigen Sequence:
SLFNANYDVQRFIVGSDRAIFMLRDGSYAWEIKDFLVGQDRCADVTLEGQVYPGKGGGSKEKNKTKQDKGKKKKEGDLKSRSSK
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



