CacheBy
Atlas Antibodies Anti-MED7 Antibody
원본

Atlas Antibodies Anti-MED7 Antibody

상품 한눈에 보기

Human MED7 단백질을 인식하는 토끼 폴리클로날 항체로, mediator complex subunit 7 연구용으로 적합합니다. IgG 아이소타입이며, PrEST 항원으로 정제되었습니다. 인체, 생쥐, 랫트 종에서 높은 반응성을 보입니다.

카탈로그번호
HPA067181-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA067181-100 Anti-MED7 Antibody, mediator complex subunit 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA067181-25 Anti-MED7 Antibody, mediator complex subunit 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MED7 Antibody

Anti-MED7 Antibody

Target Information

  • Target Protein: Mediator complex subunit 7
  • Target Gene: MED7
  • Alternative Gene Names: CRSP33, CRSP9

Product Description

Polyclonal antibody against human MED7.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

KREEKLEDLKLLFVHVHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVIEMI

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000007053 (100%)
  • Mouse ENSMUSG00000020397 (100%)

ICC (Immunocytochemistry)

Technical Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference Documents

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.