CacheBy
Atlas Antibodies Anti-MED29 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MED29 Antibody

상품 한눈에 보기

Human MED29 단백질을 인식하는 토끼 폴리클로날 항체로, Affinity 정제 방식으로 제조되었습니다. 면역형광(ICC) 등 다양한 응용에 적합하며, 40% 글리세롤과 PBS 완충액에 보존되어 있습니다. 인간, 쥐, 랫드 간 높은 서열 유사성을 가집니다.

카탈로그번호
HPA055956-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA055956-100 Anti-MED29 Antibody, mediator complex subunit 29 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055956-25 Anti-MED29 Antibody, mediator complex subunit 29 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MED29 Antibody

Anti-MED29 Antibody

Overview

Polyclonal antibody against Human MED29 (mediator complex subunit 29).

  • Immunocytochemistry (ICC)

Product Description

This antibody is a polyclonal IgG raised in rabbit, affinity purified using the PrEST antigen as affinity ligand. It is designed for detection of the human MED29 protein.

Alternative Gene Names

  • DKFZp434H247
  • IXL
  • MED2

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein Mediator complex subunit 29
Target Gene MED29
Verified Species Reactivity Human
Interspecies Homology Rat ENSRNOG00000019702 (99%)
Mouse ENSMUSG00000003444 (99%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LELCLRLAHECLSQSCDSAKHSPTLVPTATKPDAVQPDSLPYPQYLAVIKAQISCAKDIHTALLDCAN

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.