CacheBy
Atlas Antibodies Anti-MED27 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MED27 Antibody

상품 한눈에 보기

인간 MED27 단백질을 인식하는 고품질 폴리클로날 항체. IHC, WB(재조합 발현 검증), ICC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 토끼 숙주에서 생산된 IgG 형 항체.

카탈로그번호
HPA007002-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA007002-100 Anti-MED27 Antibody, mediator complex subunit 27 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA007002-25 Anti-MED27 Antibody, mediator complex subunit 27 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MED27 Antibody

Anti-MED27 Antibody

Target: Mediator complex subunit 27
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB) – Recombinant expression validation using target protein overexpression
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human MED27.


Alternative Gene Names

CRSP34, CRSP8, TRAP37


Target Information

항목 내용
Target Protein Mediator complex subunit 27
Target Gene MED27
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence KPSENHPLHNSGLLSLDPVQDKTPLYSQLLQAYKWSNKLQYHAGLASGLLNQQSLKRSANQMGVSAKRRPKAQPTTLVLPPQYVDDVISRIDR
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000026799 (100%), Rat ENSRNOG00000013933 (100%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet


제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Validation Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.