원본

Atlas Antibodies Anti-MED30 Antibody

상품 한눈에 보기

Human MED30 단백질을 인식하는 Rabbit Polyclonal 항체로, Affinity 정제 방식으로 제작되었습니다. ICC 등 다양한 응용에 적합하며, 높은 종간 보존성을 보입니다. 40% 글리세롤/PBS 버퍼에 보존제로 sodium azide가 포함되어 있습니다.

카탈로그번호: HPA045767-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA045767-100 Anti-MED30 Antibody, mediator complex subunit 30 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA045767-25 Anti-MED30 Antibody, mediator complex subunit 30 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-MED30 Antibody

Anti-MED30 Antibody

Target Information

Target Protein: Mediator complex subunit 30
Target Gene: MED30
Alternative Gene Names: THRAP6, TRAP25

Product Description

Polyclonal antibody against human MED30.
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence was used for immunization.

Antigen Sequence

MSTPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTY

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000038622 (92%)
Rat ENSRNOG00000004844 (92%)

Recommended Applications

ICC (Immunocytochemistry)

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2)
Preservative	0.02% sodium azide
Storage	Gently mix before use. Optimal concentrations and conditions should be determined by the user.